How 406 Peptides Packages and Ships Your Order
From checkout to your door: how ordering and payment work, how we pack orders in Montana, USPS shipping options and timing, and how tracking…
Oct 1, 2026Read article →
406 Peptides · Montana, USA
Montana’s research peptide supplier.
Research peptides packed and shipped from Montana. Certificates of analysis are posted by product and lot as laboratories provide them, and pricing is shown by size on every page.
Batch documentationShipped from MontanaStraightforward pricingTracked USPS shipping
68orders shipped in October
For laboratory and research use only. Not for human or veterinary use.
Documented batches
Certificates of analysis are posted to the COA library by product and lot as laboratories provide them.
Packed & shipped from Montana
Orders are packed in Montana and shipped with USPS, Monday–Friday. Flat rate $10 Ground Advantage or $13.50 Priority Mail — free over $150.
Featured this month
-
GLP3-RT
Price range: $35.00 through $95.00from $1.90 / mg -
NAD+
Price range: $40.00 through $60.00from $0.060 / mg -
Tirzepatide
Price range: $30.00 through $60.00from $1.00 / mg -
KLOW
Price range: $50.00 through $70.00from $0.88 / mg -
CJC-1295 + Ipamorelin Blend
$27.00$2.70 / mg -
New
Cagrilintide
$50.00$5.00 / mg -
GLOW (BPC-157 + GHK-Cu + TB-500)
$45.00$0.64 / mg -
Semax
$21.00$2.10 / mg
Research Notes
All articles →Latest from the lab
Lyophilized Peptides: Storage and Handling Basics for the Lab
Freeze-dried peptides are stable, but only when they are stored and handled correctly. Temperature, light, moisture and freeze-thaw cycles all matter.
Oct 1, 2026Read article →
What Is Bacteriostatic Water? A Laboratory Reference
Bacteriostatic water is sterile water with a small amount of benzyl alcohol added as a preservative. Here is how it differs from sterile water,…
Oct 1, 2026Read article →
How ordering works
- Pick your product and size. Every product page shows price by size, current lot, and the certificate of analysis when one is on file.
- Check out. Choose how you’d like to pay (Venmo, bank transfer, crypto, or card) and your USPS shipping option. No payment is taken at checkout — we email you a secure payment link.
- Track it. You get a tracking number by email when the label is created, and you can follow it any time on the order tracking page.
For laboratory and research use only. Delivery windows are the carrier’s estimates.
Why 406 Peptides
A Montana company with a short catalog, batch documentation posted as labs provide it, pricing shown openly by size, and orders packed and shipped from Montana. No account walls, no fake scarcity.
How to find a product’s documentation
Every released lot that has a certificate of analysis is listed in the COA library, filterable by product and lot number.
- Find the lot number. It is printed on the vial label and shown on the product page when supplied.
- Search the COA library. Filter by product, then by lot. Current documents are marked as such; superseded ones are archived, not deleted.
- Open the report. Each entry links to the laboratory’s certificate of analysis as provided.
- No document yet? Some lots are pending. The library shows status, and support can tell you when a report is expected.
Laboratory testing does not by itself establish sterility, FDA approval, U.S. manufacture, or suitability for any particular use.
Our pricing approach
Straightforward, highly competitive pricing shown by size on every product page. If you find a lower published price on a comparable research product, tell us — we review it.
This site does not claim to have the lowest prices in the United States. Any comparative or absolute pricing claim requires current, documented substantiation and owner approval before publication.
From Montana to your lab
Shipped to 11 states
Every order is packed in Montana and shipped USPS with tracking.
Home baseShippedNot yet
AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFL
Shipping & fulfillment
Packed in Montana
Orders are packed in Montana and shipped with USPS, Monday–Friday. We don’t ship on weekends or holidays.
USPS flat rate
$10 USPS Ground Advantage (2–5 business days) or $13.50 USPS Priority Mail (1–3 business days). Tracking is emailed when the label is created.
Free over $150
Orders over $150 ship free via USPS Ground Advantage. See shipping & returns for timing windows and the returns process.
Common questions
What does 406 Peptides sell?
Research peptides and related supplies — supplements, prepared stacks, and reconstitution items such as bacteriostatic water. Products are sold for laboratory and research use only.
Where are the certificates of analysis?
In the COA library, filterable by product and lot. If a lot’s report is still pending, the library says so.
How is my order shipped?
Packed in Montana and shipped with USPS, Monday–Friday (no weekend shipping). Flat rate: $10 Ground Advantage or $13.50 Priority Mail, and free over $150. You get the tracking number by email when the label is created.
Do you provide usage or dosing guidance?
No. These are research materials. We do not provide dosing protocols, administration guidance, or medical advice, and nothing here is intended to diagnose, treat, cure, or prevent any condition.